Protein coding transcript 201372

• Transcript: Ll_transcript_126408
• CDS coordinates: 55-450 (+)
• Peptide sequence: MEDQKQKKPRILCLHGFRTSGEILKKSVLRWPEIVTEKLDLVFLDGKFRAQGKSDVEGIFDPPYYEWFQPKKDFTVYSNFEESVAYIEDYMLKNGPFDGLLGFSQGAMIAAALSGMQAQVIRKEIIIVILI*
• ORF Type: complete

Annotations of Ll_transcript_126408

• Blastp: Esterase FUS5 from Fusarium fujikuroi species complex with 33.93% of identity
• Blastx: Esterase FUS5 from Fusarium fujikuroi species complex with 34.23% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (FVEG_11082)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445410.1)
• Pfam: Serine hydrolase (FSH1) (PF03959.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;