Transcript | Ll_transcript_282003 |
---|---|
CDS coordinates | 137-1237 (+) |
Peptide sequence | MNFADTLKLKVKPGKTYLLRLINAALNEELFFSIANHTLTIVEADGSYTKPFDTETLLIAPGQTTNVLLKTKPYYPNATFLIAARPYFSGQGTFDNSTTAAILHYNHHSHITNLTLLKPTFPPINATNFVANFTAQFRSLGSDKFPIDVPKKVDKSFFFTVGLGTNPCPKNTTCQGPNNTTKFAASVNNISFTLPSVSIMQDYYSGRWSNSVFNTDFPSSPLSTFNYTGTPPNNTNVNNGTKLVVLKFNTSVELVLQSTSILGTESHPLHLHGYDFFVVGQGFGNYDKNKDPAKFNVVDPVQRNTAGVPAGGWIVIRFRADNPGVWFMHCHLDIHTSWGLRMAWLVLDGPGPNQKLQPPPSDLPKC* |
ORF Type | complete |
Blastp | Laccase-2 from Arabidopsis with 68.41% of identity |
---|---|
Blastx | Laccase-2 from Arabidopsis with 68.41% of identity |
Eggnog | Multicopper oxidase(COG2132) |
Kegg | Link to kegg annotations (AT2G29130) |
CantataDB | Link to cantataDB annotations (CNT0001549) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450497.1) |
Pfam | Multicopper oxidase (PF00394.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer