Protein coding transcript 20142

• Transcript: Ll_transcript_282010
• CDS coordinates: 35-304 (+)
• Peptide sequence: MRILVFGLWVIISLFPELAMSITRHYTFNIEYLNVTRLCHTRNILSVNGKFPGPPLIAREGDRVLVKVVNHISNNVTIHWYVHFIMILS*
• ORF Type: complete

Annotations of Ll_transcript_282010

• Blastp: Laccase-17 from Arabidopsis with 56.41% of identity
• Blastx: Laccase-17 from Arabidopsis with 56.41% of identity
• Eggnog: Multicopper oxidase(COG2132)
• Kegg: Link to kegg annotations (AT5G60020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450497.1)
• Pfam: Multicopper oxidase (PF07732.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;