Protein coding transcript 201430

• Transcript: Ll_transcript_125335
• CDS coordinates: 1032-1529 (+)
• Peptide sequence: MIALLWPFYMIVNKFSMTIFWNFQVPFIGLAMGDRGLISRILCAKFGGYLTFGTLESGVVSAPGQPTIKDLLDLYNFRQVGPDTKVYGIIGKPVSHSKSPILHNGAFKSVGFDGVYVFLLVDDLANFLRTYSSTDFVGFSVTIPHKEAAVKCCDEVDPVAKVFGH*
• ORF Type: complete

Annotations of Ll_transcript_125335

• Blastp: Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic from Arabidopsis with 80.14% of identity
• Blastx: Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic from Arabidopsis with 63.54% of identity
• Eggnog: shikimate dehydrogenase(COG0169)
• Kegg: Link to kegg annotations (AT3G06350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431914.1)
• Pfam: Type I 3-dehydroquinase (PF01487.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;