Protein coding transcript 201456

• Transcript: Ll_transcript_126853
• CDS coordinates: 170-478 (+)
• Peptide sequence: MASPSLYRRTLPSPPAIEFSSHEGKKIFGEALSQGTMEGFFKLISYYQTQSEPAYCGLATVSVVLNALSIDPGRKWKGMLFLSSFFNPHFSFIMLMFPFVRV*
• ORF Type: complete

Annotations of Ll_transcript_126853

• Blastp: Glutathione gamma-glutamylcysteinyltransferase 2 from Lotus with 87.18% of identity
• Blastx: Glutathione gamma-glutamylcysteinyltransferase 2 from Lotus with 87.18% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425945.1)
• Pfam: Phytochelatin synthase (PF05023.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;