Protein coding transcript 20157

• Transcript: Ll_transcript_281198
• CDS coordinates: 1086-1481 (+)
• Peptide sequence: MEIQVNGGTIAQKVDYAYNFFEKQIPVNAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKVYKVGKSGEESHTAITEFDRYVCYRLSF*
• ORF Type: complete

Annotations of Ll_transcript_281198

• Blastp: 60S ribosomal protein L3 from Oryza sativa with 90.24% of identity
• Blastx: 60S ribosomal protein L3 from Oryza sativa with 78.03% of identity
• Eggnog: One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit (By similarity)(COG0087)
• Kegg: Link to kegg annotations (4351604)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434008.1)
• Pfam: Ribosomal protein L3 (PF00297.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;