Protein coding transcript 201640

• Transcript: Ll_transcript_127299
• CDS coordinates: 165-1244 (+)
• Peptide sequence: MDTKSAVDLMESSAEVHFSGFHMDSFEQRKDDIEQPTTSATNMYRQPFVIGVAGGAASGKTTVCDMIIQQLHDQRVVLVNQDSFYHNLTEEELTRVQDYNFDHPDAFDTEQLLRVMDKLKCGEAVDIPKYDFRSYKSDLLPSRRVNPSDVIILEGILVFHDPRVRELMNMKIFVDTDADVRLARRIRRDTAEKGRDIGTVLDQYSKFVKPAFDDFILPTKKYADIIIPRGGDNHVAVDLIVQHIRTKLGQHDLCKIYPNLYVIHSTFQIRGMHTLIRDSQITKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVTTPTGKLSFSTLISLACIICTAVEASFSCKVLWMMCMLGTVILLSQK*
• ORF Type: complete

Annotations of Ll_transcript_127299

• Blastp: Uridine kinase-like protein 4 from Arabidopsis with 79.62% of identity
• Blastx: Uridine kinase-like protein 4 from Arabidopsis with 79.75% of identity
• Eggnog: Catalyzes the conversion of uracil and 5-phospho-alpha- D-ribose 1-diphosphate (PRPP) to UMP and diphosphate (By similarity)(COG0035)
• Kegg: Link to kegg annotations (AT4G26510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447037.1)
• Pfam: Phosphoribulokinase / Uridine kinase family (PF00485.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;