Protein coding transcript 201641

• Transcript: Ll_transcript_127300
• CDS coordinates: 677-1270 (+)
• Peptide sequence: MILNNCFSRSLSMDTKSAVDLMESSAEVHFSGFHMDSFEQRKDDIEQPTTSATNMYRQPFVIGVAGGAASGKTTVCDMIIQQLHDQRVVLVNQDSFYHNLTEEELTRVQDYNFDHPDAFDTEQLLRVMDKLKCGEAVDIPKYDFRSYKSDLLPSRRVNPSDVIILEGILVFHDPRVRELMNMKIFVDTGPLLLLFHH*
• ORF Type: complete

Annotations of Ll_transcript_127300

• Blastp: Uridine kinase-like protein 3 from Arabidopsis with 68.93% of identity
• Blastx: Uridine kinase-like protein 4 from Arabidopsis with 92.57% of identity
• Eggnog: Catalyzes the conversion of uracil and 5-phospho-alpha- D-ribose 1-diphosphate (PRPP) to UMP and diphosphate (By similarity)(COG0035)
• Kegg: Link to kegg annotations (AT1G55810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447039.1)
• Pfam: Zeta toxin (PF06414.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;