Transcript | Ll_transcript_127286 |
---|---|
CDS coordinates | 3-824 (+) |
Peptide sequence | HNHHSVLLLLKLLLYGVISNNSCLVNLPFTISVHFTTSPFPPLTQIVELTRSLSMDTKSAVDLMESSAEVHFSGFHMDSFEQRKDDIEQPTTSATNMYRQPFVIGVAGGAASGKTTVCDMIIQQLHDQRVVLVNQDSFYHNLTEEELTRVQDYNFDHPDAFDTEQLLRVMDKLKCGEAVDIPKYDFRSYKSDLLPSRRVNPSDVIILEGILVFHDPRVRELMNMKIFVDTDADVRLARRIRRDTAEKGRDIGTVLDQVATFCHIAHIYFTARL* |
ORF Type | 5prime_partial |
Blastp | Uridine kinase-like protein 3 from Arabidopsis with 69.81% of identity |
---|---|
Blastx | Uridine kinase-like protein 4 from Arabidopsis with 92.57% of identity |
Eggnog | Catalyzes the conversion of uracil and 5-phospho-alpha- D-ribose 1-diphosphate (PRPP) to UMP and diphosphate (By similarity)(COG0035) |
Kegg | Link to kegg annotations (AT1G55810) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447037.1) |
Pfam | Zeta toxin (PF06414.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer