Protein coding transcript 201668

• Transcript: Ll_transcript_125569
• CDS coordinates: 70-1641 (+)
• Peptide sequence: MSHTLGLTHPSIIQSPKISFSAKEIDVTEWKGDILAVGVTVKDLARDSNSNFENSILKKLDSKLGGLLAEASSEEDFSGKVGQSIFLRIAGFGSKRVGLIGLGQSASTPAAFKGFGEAFAAAAKSAQASNAAIVLASSEGLSAQSKLSSAYAIASGAVLGLFEDNRYKSESKKPALSSVDIIGLGSGPELDKKLKYAGYVSSGIIFGRELVNSPANVLTPGVLAEEASKIASTYSDVFTSTILNAEQCKELKMGSYLGVAEASANPPHFIHLRYKPPSGPVNVKLALVGKGLTFDSGGYNIKTGPGCSIEFMKFDMGGSAAVFGAAKALGQIKPLGVEVHFIAAACENMISGTGMRPGDIVTASNGKTVEVNNTDAEGRLTLADALVYACNQGVEKVVDLATLTGACAVALGPTIAGVFTPNDDPAKEVLEASEVSGEKLWRLPLEESYWESMKSGVADMKNSGSRQGGAICAALFLKQFVDEKVQWVHIDMVGPVWNYKKRSATGFGVATLVEWVLKNSSYI*
• ORF Type: complete

Annotations of Ll_transcript_125569

• Blastp: Leucine aminopeptidase 1 from Arabidopsis with 76.58% of identity
• Blastx: Leucine aminopeptidase 1 from Arabidopsis with 76.58% of identity
• Eggnog: Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides (By similarity)(COG0260)
• Kegg: Link to kegg annotations (AT2G24200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441552.1)
• Pfam: Cytosol aminopeptidase family, N-terminal domain (PF02789.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;