Protein coding transcript 201706

• Transcript: Ll_transcript_125308
• CDS coordinates: 1-678 (+)
• Peptide sequence: IKGMDKIASTPPIRVQGPIIVGAGPSGVAVAALLKQKAIPSLILEKADCLASMWQLKTYDRLCLHLPKQFCQLPLMPFPKTFPSYPTKQHFLTYLKTYAEKFDVKPAFSTVVVSAEFDHRSGFWRVKTKGMKKKEEVEYVCQWLIVATGENAEEVVPQIEGMDEFEGTILHSSLYKRGSMFGGKNVLVVGCGNSGMEVCLDLCNHNAHPSLVVRNTVCTLIVVII*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_125308

• Blastp: Indole-3-pyruvate monooxygenase YUCCA2 from Arabidopsis with 63.55% of identity
• Blastx: Indole-3-pyruvate monooxygenase YUCCA2 from Arabidopsis with 64.9% of identity
• Eggnog: Monooxygenase(COG2072)
• Kegg: Link to kegg annotations (AT4G13260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436640.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF13738.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;