Protein coding transcript 201745

• Transcript: Ll_transcript_125718
• CDS coordinates: 124-1086 (+)
• Peptide sequence: MALLNPFSLYISISFFFFFSFSFSNAKDSSFSSPTTSSDVQLLLLKIKPLLQSNSDNLVLSSWNTSTPLCQWRGLKWVFTNASILSCTDLSSPQWTNLSLHNDPSLNLLSLQLPSANLSGSLPREIGEFPMLQSLYLNINSLKGTIPLELGYSTSLSDIDLSYNLFIGVLPPSIWNLCESDRLLSLKLHGNSLTGSVSEPALPNSTCKDLQFLDLGSNKFSGDFPEFVTKFGALKQLDLGDNMFVSTIPQSLAELRLEKLNLSHNNFSGVLPFFGESKFGVDAFEGNKPDLCGPPLKIYGSNNSSLSSGAVAGIIISLMT*
• ORF Type: complete

Annotations of Ll_transcript_125718

• Blastp: Putative kinase-like protein TMKL1 from Arabidopsis with 65.37% of identity
• Blastx: Putative kinase-like protein TMKL1 from Arabidopsis with 69.93% of identity
• Eggnog: kinase-like protein(ENOG4111F3A)
• Kegg: Link to kegg annotations (AT3G24660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450203.1)
• Pfam: Leucine rich repeat N-terminal domain (PF08263.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;