Protein coding transcript 201794

• Transcript: Ll_transcript_127162
• CDS coordinates: 182-1132 (+)
• Peptide sequence: MDSPSNPYLPLLQALFQIPFHHYLIAISFALIVYLYDFIESHFLQDLFSGFTGSPVELTYNSCSQLYQAVVSKCKILHGSYLATPWLSSPHIQTCFLNFFGNPPVFNYKRQLFTTPDGGTLALDWLMSSDVSGGASHTDSVVSEDESTPIVVVIPGLTSDSSSAYLKHLAYHTAKRGWNVVVSNHRGLGGVSITSDCFYNAGWTEDVRTVINYLHKEQPKTTLFLVGTSIGANILIKFLGEDGENIPIAGAVAVCSPWDLLISDRFITRKRVQKFYDRALAVGLQGYAKLHQPLFSRLANWEGIEKVAFLSVIRYL*
• ORF Type: complete

Annotations of Ll_transcript_127162

• Blastp: Embryogenesis-associated protein EMB8 from Picea with 32.67% of identity
• Blastx: Embryogenesis-associated protein EMB8 from Picea with 32.67% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453648.1)
• Pfam: Serine aminopeptidase, S33 (PF12146.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;