Protein coding transcript 201955

• Transcript: Ll_transcript_126714
• CDS coordinates: 970-1473 (+)
• Peptide sequence: MSFSYLQANKKIADAKLAKDFQAVLKEFQKAQRLASERETAYTPFVPQTALSPSELDVSSDKPPEQRALLVESKRQEVLFLDNEIAFNEAIIEEREQGIQEIQQQIGEVNEIFKDLALLVNEQGTMIDDIGSNIENSHAATAQAKSQLAKASKTQRSNSSLACLLLVI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_126714

• Blastp: Syntaxin-22 from Arabidopsis with 75.15% of identity
• Blastx: Syntaxin-22 from Arabidopsis with 75.15% of identity
• Eggnog: SYNtaxin(COG5325)
• Kegg: Link to kegg annotations (AT5G46860)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424433.1)
• Pfam: Syntaxin-like protein (PF14523.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;