Protein coding transcript 202083

• Transcript: Ll_transcript_127334
• CDS coordinates: 345-986 (+)
• Peptide sequence: MEKGVRERIKTTRQVIGEAKESFDNQIKIQKLKDTIFAVNEQLTKAKKQGAFSSLIAAKSIPKILHCLSMRLMEERIAHPEKYSDEGKLTPPEVEDPKLYHYAIFSDNVVAVSVVVNSARKNAKEPWKHVFHVVTDKMNLGAMQVMFKLKDYNGAHIEVKAVEDYKFLNSSYVPVLRQLESANLQRFYFENKLENATKDTTNMKYRNPKYFQY*
• ORF Type: complete

Annotations of Ll_transcript_127334

• Blastp: Galacturonosyltransferase 8 from Arabidopsis with 87.68% of identity
• Blastx: Galacturonosyltransferase 8 from Arabidopsis with 82.03% of identity
• Eggnog: Galacturonosyltransferase(ENOG410YC9Z)
• Kegg: Link to kegg annotations (AT3G25140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461511.1)
• Pfam: Glycosyl transferase family 8 (PF01501.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;