Protein coding transcript 202100

• Transcript: Ll_transcript_126277
• CDS coordinates: 168-863 (+)
• Peptide sequence: MEKLIPILLLCVLNIVLNFKIIALADDNGSSGIASSESSSSSSSSSSCKNTNYQTFLPPPFQNISSTICKPVWNTYELRYTRIGDTTSIILSAPYTLGWVGIGFSKDGMMVGSSAMVGWINKHGHANIKQYYLRGKKHSEVIADKGELPLNNVPAAVATNGAEIYLAFQLQTTTPFGKQPILLAFGTKLPQNHHLSKHEDKTAIVFDFSSGATSFLSHFTISKACLRCAIL*
• ORF Type: complete

Annotations of Ll_transcript_126277

• Blastp: Cytochrome b561 and DOMON domain-containing protein At3g61750 from Arabidopsis with 46.58% of identity
• Blastx: Cytochrome b561 and DOMON domain-containing protein At3g61750 from Arabidopsis with 53.49% of identity
• Eggnog: auxin-responsive protein(ENOG410Y10S)
• Kegg: Link to kegg annotations (AT3G61750)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424136.1)
• Pfam: DOMON domain (PF03351.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;