Protein coding transcript 202146

• Transcript: Ll_transcript_125751
• CDS coordinates: 1070-1390 (+)
• Peptide sequence: MASKELPKQCIRFGTNAAKYASRKNVGVRMPEDAICQAILKEMDAPLICTSIKFLKEDEWMIDPVMIADTYGPEGLDFVVAGGVRVAEPSTVVDMTKMPPRVLRQGK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_125751

• Blastp: Uncharacterized protein HI_1198 from Haemophilus with 30.84% of identity
• Blastx: Uncharacterized protein HI_1198 from Haemophilus with 33.63% of identity
• Eggnog: sua5 ycio yrdc ywlc family protein(COG0009)
• Kegg: Link to kegg annotations (HI1198)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004514618.1)
• Pfam: Telomere recombination (PF01300.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;