| Transcript | Ll_transcript_125281 |
|---|---|
| CDS coordinates | 52-360 (+) |
| Peptide sequence | MATNASSSSSSSRATMFYYAVNEEPHFLEACFLCRKSLGQNSDIFMYRGNTPFCSKECRDEQIENDEAKEKSWKHSSKRSVRQSETNQNSNETSRTGTVVVS* |
| ORF Type | complete |
| Blastp | Protein MARD1 from Arabidopsis with 48.78% of identity |
|---|---|
| Blastx | - |
| Eggnog | Protein of unknown function (DUF581)(ENOG41105YW) |
| Kegg | Link to kegg annotations (AT3G63210) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019463139.1) |
| Pfam | zinc-finger of the FCS-type, C2-C2 (PF04570.13) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer