Protein coding transcript 202226

• Transcript: Ll_transcript_125527
• CDS coordinates: 275-817 (+)
• Peptide sequence: MIWRSEQTSPKKSEQKPQSFARVSPLTCLKDHPRKGEKLTLSPSGTLAAITDSLGRILLLDTQALVVVRLWKGYRDASCLFMEILVNKDTASTSSTNREPVKSDYCLCLAIHAPRKGIIEIWQMRTGPRLRTIRCRKGSKMLQPSYRFGASMSSPYVPLEVFLLNGDSGVISVINRNMDS*
• ORF Type: complete

Annotations of Ll_transcript_125527

• Blastp: Rab3 GTPase-activating protein non-catalytic subunit from Rattus with 34.16% of identity
• Blastx: Rab3 GTPase-activating protein non-catalytic subunit from Rattus with 32.97% of identity
• Eggnog: RAB3 GTPase activating protein subunit 2 (Non-catalytic)(ENOG410XTJ2)
• Kegg: Link to kegg annotations (289350)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464919.1)
• Pfam: Rab3 GTPase-activating protein regulatory subunit N-terminus (PF14655.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;