Protein coding transcript 202305

• Transcript: Ll_transcript_124951
• CDS coordinates: 319-801 (+)
• Peptide sequence: MRNSPNERTFFWTQANALLRKNLTYQKRNVKTNVRLILFPFVLCLLMLLLQKLIEKQILDKPENKCGCICTKTQGDKCLEKECGIQYSDLSQVGTCPIPHPPEWPPLMQVPVPQYRAVKSIFLPFLDLPDESCRKNGSCPISMFFTGNNMSFGESMYISP*
• ORF Type: complete

Annotations of Ll_transcript_124951

• Blastp: ABC transporter A family member 3 from Arabidopsis with 46.58% of identity
• Blastx: ABC transporter A family member 3 from Arabidopsis with 47.55% of identity
• Eggnog: (ABC) transporter(COG1131)
• Kegg: Link to kegg annotations (AT3G47740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429341.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;