Transcript | Ll_transcript_124943 |
---|---|
CDS coordinates | 264-644 (+) |
Peptide sequence | MEEAEVLCDRLGIFVGGSLQCIGNPNELKARYGGTYVFTMTASLDHEKDVENLVLQLSPNAKKIYHISGTQKFELPKDEVRISNVFQAVNDAKRNFTVSAWGLADTTLEDVFIKVARSAQEFETLS* |
ORF Type | complete |
Blastp | ABC transporter A family member 3 from Arabidopsis with 76.98% of identity |
---|---|
Blastx | ABC transporter A family member 3 from Arabidopsis with 74.63% of identity |
Eggnog | (ABC) transporter(COG1131) |
Kegg | Link to kegg annotations (AT3G47740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429341.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer