Protein coding transcript 202335

• Transcript: Ll_transcript_126647
• CDS coordinates: 299-1180 (+)
• Peptide sequence: MIYRVSYFMDEIWERAVETALDGETDHASVRTLTLDGAVKCVQGRLPPPSLLERFQNLGHLSVANIGVSSLEQFPRLSNLQKLILSDNRIAGGLEFLVEAGLDSLRDLDLSNNRIQFIEDLVPLAQLKLVSLDLYECPVTRVKDYRSRVFGLINSLKYLDKMDAEENERPESDDEDEEDEEEEDDPGSGEIDGEDRPLAMSNGHGEGVDGVVDVDEEEESEADEEEAETSRRVNGLNQENGFRMESVAWDEEDKDDDEEEEDEIDEEDGDDDKDDDEEEEDEIDEEDGDDDEED
• ORF Type: 3prime_partial

Annotations of Ll_transcript_126647

• Blastp: Acidic leucine-rich nuclear phosphoprotein 32-related protein from Arabidopsis with 69.12% of identity
• Blastx: Acidic leucine-rich nuclear phosphoprotein 32-related protein from Arabidopsis with 86.54% of identity
• Eggnog: Acidic leucine-rich nuclear phosphoprotein 32 family member(ENOG4111HZT)
• Kegg: Link to kegg annotations (AT3G50690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421754.1)
• Pfam: Leucine-rich repeat (PF14580.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;