Protein coding transcript 202391

• Transcript: Ll_transcript_125940
• CDS coordinates: 1071-1526 (+)
• Peptide sequence: MRPTYTIEGYLYLSADYIETNYKLNSQTLNFCHMSLPHIGPKMCATVLEFLKGGEIDKKICCLTLDTISENDTMVRILKIKLTHEDNGLVGKYFLVRCYARPLEYIVQDIMKVSRDTLQKIEENIKYVKDSEIRKIAFMKCIAKCGSLIDS*
• ORF Type: complete

Annotations of Ll_transcript_125940

• Blastp: Zinc finger BED domain-containing protein RICESLEEPER 2 from Oryza sativa with 29.55% of identity
• Blastx: Putative AC transposase from Zea with 28.14% of identity
• Eggnog: transposon protein(ENOG410Y37V)
• Kegg: Link to kegg annotations (4334009)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414580.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;