Protein coding transcript 20240

• Transcript: Ll_transcript_281224
• CDS coordinates: 1970-2275 (+)
• Peptide sequence: MRLSQQQSSLQKWLKSNLLNRGKMRSNMDARLEGKYPPKLAFEVAQLSRKCIQTEAKVRPSMVEVLETLEKIAAANENPANSMKRGTRSRTVHQNGQADGG*
• ORF Type: complete

Annotations of Ll_transcript_281224

• Blastp: Probable serine/threonine-protein kinase PIX13 from Arabidopsis with 56.63% of identity
• Blastx: Probable serine/threonine-protein kinase PIX13 from Arabidopsis with 63.06% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G17220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464558.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;