Protein coding transcript 202486

• Transcript: Ll_transcript_124606
• CDS coordinates: 147-767 (+)
• Peptide sequence: MEKELLELYGAAKTAADAASSGDGEVEESRCIDALQQLKKFPVNYKILVTTQVGKHLKSLTKHPRQKIRAFAVDLIEIWKNIIIKETSKNKNGGSDNKVEPGNGERAKVAKFQKSPSVKVEKAETVKVEKIDRKGTPSSSSDSTKKAQNVDARIEKTDHAANGKVEKQVSGVKRTSSISAAPPKLKTMIKSNDSVRDKIRELLQEAL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_124606

• Blastp: Transcription elongation factor TFIIS from Arabidopsis with 43.16% of identity
• Blastx: Transcription elongation factor TFIIS from Arabidopsis with 42.29% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG1594)
• Kegg: Link to kegg annotations (AT2G38560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437269.1)
• Pfam: TFIIS helical bundle-like domain (PF08711.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;