Protein coding transcript 202503

• Transcript: Ll_transcript_126494
• CDS coordinates: 1368-1784 (+)
• Peptide sequence: MSLQYFLYQLLRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILMEIIRRKPLFPGKDYVQQLALITEVFVFSLQCLKFVQLPGKFSILGV*
• ORF Type: complete

Annotations of Ll_transcript_126494

• Blastp: Mitogen-activated protein kinase homolog NTF6 from Nicotiana with 91.82% of identity
• Blastx: Mitogen-activated protein kinase homolog NTF6 from Nicotiana with 81.06% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448687.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;