Transcript | Ll_transcript_126480 |
---|---|
CDS coordinates | 1349-1765 (+) |
Peptide sequence | MSLQYFLYQLLRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILMEIIRRKPLFPGKDYVQQLALITEVFVFSLQCLKFVQLPGKFSILGV* |
ORF Type | complete |
Blastp | Mitogen-activated protein kinase homolog NTF6 from Nicotiana with 91.82% of identity |
---|---|
Blastx | Mitogen-activated protein kinase homolog NTF6 from Nicotiana with 91.82% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020215101.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer