| Transcript | Ll_transcript_127127 |
|---|---|
| CDS coordinates | 225-575 (+) |
| Peptide sequence | MKTRRGRRSEVFWPSIVIKKWLNIKPKVYDFSEDEVDNENEAESEDDDSRMSVHEDKTCKTKPIFPRQTSSGKSQCIICSLSYRLWYVIACHGYNLDNSCFLKSLESKLSILLWFA* |
| ORF Type | complete |
| Blastp | Type I inositol polyphosphate 5-phosphatase 2 from Arabidopsis with 76.6% of identity |
|---|---|
| Blastx | Type I inositol polyphosphate 5-phosphatase 2 from Arabidopsis with 80.65% of identity |
| Eggnog | inositol(COG5411) |
| Kegg | Link to kegg annotations (AT4G18010) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019433331.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer