Protein coding transcript 202620

• Transcript: Ll_transcript_124612
• CDS coordinates: 378-1136 (+)
• Peptide sequence: MKQERRMAIYSEFCEKRSVLFCTDVAARGLDFNKAVDWVVQVDCPENVASYIHRVGRTARYKSGGKSVLFLLPSEIQMLEKFKAAKVPVHFNKPRKELLQPVSALLASLLAKYPDLQPRAQRAFITYLRSIHLQKDKEIFDVLKLPIDEYAASLGLPMTPKIRFLNQKIKSKAVSKEQILAEPESPKKENALIVTKKKLATDDSNDEEEDNDLFMAADTLNEDEGKASEIGEVMYVPFLSICFQQHIQNFIS*
• ORF Type: complete

Annotations of Ll_transcript_124612

• Blastp: DEAD-box ATP-dependent RNA helicase 32 from Arabidopsis with 63.81% of identity
• Blastx: DEAD-box ATP-dependent RNA helicase 32 from Arabidopsis with 68.52% of identity
• Eggnog: purine NTP-dependent helicase activity(COG0513)
• Kegg: Link to kegg annotations (AT5G54910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435563.1)
• Pfam: Helicase conserved C-terminal domain (PF00271.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;