Transcript | Ll_transcript_124628 |
---|---|
CDS coordinates | 134-475 (+) |
Peptide sequence | MSEFETSIPTAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEFSYTKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKEHIKIHGF* |
ORF Type | complete |
Blastp | Protein translation factor SUI1 homolog from Salix with 92.04% of identity |
---|---|
Blastx | Protein translation factor SUI1 homolog from Salix with 92.04% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000395) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435364.1) |
Pfam | Translation initiation factor SUI1 (PF01253.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer