Protein coding transcript 202627

• Transcript: Ll_transcript_124639
• CDS coordinates: 312-629 (+)
• Peptide sequence: MSELDAQIPTTFDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVCLLISSCYTIIYPVLHQITCLLV*
• ORF Type: complete

Annotations of Ll_transcript_124639

• Blastp: Protein translation factor SUI1 homolog from Brassica with 88.24% of identity
• Blastx: Protein translation factor SUI1 homolog 1 from Arabidopsis with 73.39% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0002183)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437123.1)
• Pfam: Translation initiation factor SUI1 (PF01253.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;