Protein coding transcript 202629

• Transcript: Ll_transcript_124648
• CDS coordinates: 1216-1557 (+)
• Peptide sequence: MSEFDTNIPTAFDPFAEANAEDSGAGTKEYVHVRVQQRNGRKSLTTVQGLKKEYSYTKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDNIKIHGF*
• ORF Type: complete

Annotations of Ll_transcript_124648

• Blastp: Protein translation factor SUI1 homolog 1 from Arabidopsis with 92.92% of identity
• Blastx: Protein translation factor SUI1 homolog 1 from Arabidopsis with 92.92% of identity
• Eggnog: translation initiation factor(COG0023)
• Kegg: Link to kegg annotations (AT4G27130)
• CantataDB: Link to cantataDB annotations (CNT0000395)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451041.1)
• Pfam: Translation initiation factor SUI1 (PF01253.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;