Protein coding transcript 202631

• Transcript: Ll_transcript_124654
• CDS coordinates: 1083-1439 (+)
• Peptide sequence: MIYRKTIYKYCVVVPTLVDPFAEANAEDSGAGTKEYVHIRIQQRNGRKSLTTVQGLKKEFSYNKILKDLKKEFCCNGTVVQDPELGQVIQLQGDQRKNVSTFLVQAGIVKKDHIKIHGF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_124654

• Blastp: Protein translation factor SUI1 homolog 2 from Arabidopsis with 90.74% of identity
• Blastx: Protein translation factor SUI1 homolog 2 from Arabidopsis with 90.74% of identity
• Eggnog: translation initiation factor(COG0023)
• Kegg: Link to kegg annotations (AT1G54290)
• CantataDB: Link to cantataDB annotations (CNT0000395)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437123.1)
• Pfam: Translation initiation factor SUI1 (PF01253.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;