| Transcript | Ll_transcript_125188 |
|---|---|
| CDS coordinates | 136-495 (+) |
| Peptide sequence | MTRRCSHCSNNGHNSRTCPHRGGGGGGGGGGLGVKLFGVRLTDGLIIKKSASMGNLSAHYHSLNSNSPTLVANPGSPCFDPTHEHAGYLSDDPAHASSFANRRGERKKGIVAFFAFAYFI |
| ORF Type | 3prime_partial |
| Blastp | Transcription factor MYBS3 from Oryza sativa with 54.05% of identity |
|---|---|
| Blastx | Transcription factor MYBS3 from Oryza sativa with 54.05% of identity |
| Eggnog | Transcription factor(ENOG4111IMA) |
| Kegg | Link to kegg annotations (4349385) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019458927.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer