Transcript | Ll_transcript_125202 |
---|---|
CDS coordinates | 2168-2752 (+) |
Peptide sequence | MIHEYYVVYFLFFATYLTAIFIYQSSDPPSVPEEQLLLTSHENSQPSHTKSHPSLDLSLKSEFEPMETTTNQKNEEEPNKTMPASNGMTPMSLAFFPAYVPVPFSIWPSITPSFDELNGETYHNQVVKPIAVKEPVNVEELVGMSHLSIGERQVFKREPSPLSLRLSGEPTRQSAFHANAPVGGTRKNSVIQAV* |
ORF Type | complete |
Blastp | Transcription factor KUA1 from Arabidopsis with 39.81% of identity |
---|---|
Blastx | Transcription factor KUA1 from Arabidopsis with 88.41% of identity |
Eggnog | Transcription factor(ENOG4111IMA) |
Kegg | Link to kegg annotations (AT5G47390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458927.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer