Transcript | Ll_transcript_126967 |
---|---|
CDS coordinates | 50-550 (+) |
Peptide sequence | MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMRPRSMAKELGGTVKEILGTCVSVGCTVDGKDPKDLQTEIDDGDVEVPQD* |
ORF Type | complete |
Blastp | 60S ribosomal protein L12 from Prunus with 92.17% of identity |
---|---|
Blastx | 60S ribosomal protein L12 from Prunus with 92.17% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414002.1) |
Pfam | Ribosomal protein L11, N-terminal domain (PF03946.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer