Protein coding transcript 202831

• Transcript: Ll_transcript_126974
• CDS coordinates: 50-532 (+)
• Peptide sequence: MPPKFVPSQVVAVYVRVPGGAVGAARSLAPKLGPLGLPPKKIGEDIAKETAKDWKGLRVTVKLTVQNRQAKVSVVPSAAALVIKALKEPERDRKKTKNIKHNGNISLDDVIEIARVMRPRSMAKELGGTVKEILGTCVSVGCTVDGKDPKDLQTEIDDGDV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_126974

• Blastp: 60S ribosomal protein L12 from Prunus with 88.82% of identity
• Blastx: 60S ribosomal protein L12-3 from Arabidopsis with 86.96% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414002.1)
• Pfam: Ribosomal protein L11, N-terminal domain (PF03946.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;