Protein coding transcript 202891

• Transcript: Ll_transcript_192017
• CDS coordinates: 330-1127 (+)
• Peptide sequence: MNTEQFQRNNMYIETPEAYGDGGKNFDDDGREKRTGTWVTASAHIITAVIGSGVLSLAWAIAQMGWVAGPAVLFAFSFITYFTSTLLADCYRSPHPVTGKRNYTYSQVVRSTLGGRKFQLCGLAQYINLVGVTIGYTITASISMVAVKRSNCFHKHGHEDKCYTSNNPFMILFACIQIILSQIPNFHKLSWLSIVAAVMSFAYSSIGLGLSIAKVATGGEHVRTSLTGVQVGVDVTGSEKVWRTFQAIGDIAFAYAYSNVLIEIQD
• ORF Type: 3prime_partial

Annotations of Ll_transcript_192017

• Blastp: Amino acid permease 6 from Arabidopsis with 80.99% of identity
• Blastx: Amino acid permease 6 from Arabidopsis with 80.99% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT5G49630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417730.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;