Protein coding transcript 202915

• Transcript: Ll_transcript_193168
• CDS coordinates: 2-601 (+)
• Peptide sequence: TNWSMVEKITVDSATLFNKGLEVIEAHYLFGADYDDIEIVIHAQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRIRCSEITWPRLDLCKLGSLTFKAPDNVKYPSMNLAYAAGRAGGTMTGVLSAANEKAVELFIDEKISYLDIFKVVELTCEKHQNELVTSPSLEEIVHYDQWARKFAASLQSSSVLTPVPA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_193168

• Blastp: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Oryza sativa with 88.32% of identity
• Blastx: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Oryza sativa with 88.32% of identity
• Eggnog: Catalyzes the NADP-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP) (By similarity)(COG0743)
• Kegg: Link to kegg annotations (4326153)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456932.1)
• Pfam: 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal (PF08436.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;