Protein coding transcript 202917

• Transcript: Ll_transcript_193173
• CDS coordinates: 2-526 (+)
• Peptide sequence: TNWSMVEKITVDSATLFNKGLEVIEAHYLFGADYDDIEIVIHAQSIIHSMIETQDSSVLAQLGWPDMRLPILYTLSWPDRVHCSEVTWPRLDLAKLGSLTFKAPDNVKYPSMNLAYAAGRAGGTMTGVLSAANEKAVELFIDEKISYLDIFKVVELTCEKHQSELVTSPSLEEIV
• ORF Type: internal

Annotations of Ll_transcript_193173

• Blastp: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Arabidopsis with 91.95% of identity
• Blastx: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic from Arabidopsis with 91.95% of identity
• Eggnog: Catalyzes the NADP-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP) (By similarity)(COG0743)
• Kegg: Link to kegg annotations (AT5G62790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463865.1)
• Pfam: 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal (PF08436.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;