Protein coding transcript 203000

• Transcript: Ll_transcript_193990
• CDS coordinates: 154-672 (+)
• Peptide sequence: MTSVFLSTVGTLLGAMTGALIGQETESGFIRGAGVGAISGAVFSIEVFESSLDLWQSDESGIVCLLYLVDVIASLLSGRLVRERIGPAMLSAVQSQMGAVETGFDEVQNIFDVGGSKGLSGDSVEKIPKIKITSENNIGGSGERVSCSVCLQDFQLGETVRSLPHCHHMFHLP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_193990

• Blastp: NEP1-interacting protein 1 from Arabidopsis with 79.53% of identity
• Blastx: NEP1-interacting protein 1 from Arabidopsis with 77.71% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G35840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421115.1)
• Pfam: Glycine-zipper domain (PF13436.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;