| Transcript | Ll_transcript_193981 |
|---|---|
| CDS coordinates | 376-762 (+) |
| Peptide sequence | MQIDVIASLLSGRLVRERIGPAMLSAVQSQVILRFVKRITYYSDEIEICLCTLMLLIPLFFFTRWVLLKPASMRFKTSLTLVVQKVYQEIQLRKSQKSKLLVTTISMVPVKEFLVQFASRFVFCSFDY* |
| ORF Type | complete |
| Blastp | NEP1-interacting protein-like 1 from Arabidopsis with 96.55% of identity |
|---|---|
| Blastx | NEP1-interacting protein 1 from Arabidopsis with 42.37% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (AT5G66070) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020216951.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer