Protein coding transcript 203070

• Transcript: Ll_transcript_192450
• CDS coordinates: 1856-2347 (+)
• Peptide sequence: MENQMRHLVYLLENAMLNLPPDQEQMAWLIDFTGWSITNTPIKSARETINILQNHYPERLAIAFLYNPPRVFEAFWKIVKYFLDNKTFQKVKFVYPKNKDSVELMKSHFDEENLPKEFGGKSILTYNYEEFSRLMAEDDLKCVAFWESDNNLTNHIGDENSAA*
• ORF Type: complete

Annotations of Ll_transcript_192450

• Blastp: CRAL-TRIO domain-containing protein C23B6.04c from Schizosaccharomyces with 34.88% of identity
• Blastx: CRAL-TRIO domain-containing protein C23B6.04c from Schizosaccharomyces with 34.31% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPCC23B6.04c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443185.1)
• Pfam: CRAL/TRIO domain (PF00650.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;