Protein coding transcript 203258

• Transcript: Ll_transcript_193338
• CDS coordinates: 1326-1886 (+)
• Peptide sequence: MLQSLKSRGIQFPGRDNESLAPIFTPPHSVSAPEADVQIHAHDDVPVLSFTPEQTKEAFDVARNSIELLSTVLSSSPQQDVLQDDLTTTLVQQCRRSQATVLRIIETAEDNEALLFEALNVNDEIQKVLSKYEELKVPTVVPVPHEPAMIPVAVEPDESPQHTKEDALIRKPVGSRAGAHGGSNDHM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_193338

• Blastp: TOM1-like protein 1 from Arabidopsis with 71.75% of identity
• Blastx: TOM1-like protein 1 from Arabidopsis with 77.71% of identity
• Eggnog: gamma adaptin ear containing, arf binding protein(ENOG410Y26G)
• Kegg: Link to kegg annotations (AT5G16880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424359.1)
• Pfam: GAT domain (PF03127.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;