Transcript | Ll_transcript_191556 |
---|---|
CDS coordinates | 1368-2069 (+) |
Peptide sequence | MAKGSGMIHPNMATMLGVVTTDARVNSDVWRKMVRIAVNRSFNQITVDGDTSTNDTVIALASGLSGLRCISSLDSDEATQLQACLDAVMQGLAKSIAWDGEGATCLIEVTVVGANSEAEAAKVARSVASSSLVKAAVYGRDPNWGRIAAAAGYSGVPFHQSLLRVELGDILLMDGGEPQLFDRDAASNYLRKAGETHDTVRIQISIGNGPGHGQAWGCDLSYDYVKINAEYTT* |
ORF Type | complete |
Blastp | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic from Citrullus with 83.4% of identity |
---|---|
Blastx | Arginine biosynthesis bifunctional protein ArgJ, chloroplastic from Citrullus with 82.93% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440952.1) |
Pfam | ArgJ family (PF01960.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer