Protein coding transcript 203299

• Transcript: Ll_transcript_191577
• CDS coordinates: 1368-1919 (+)
• Peptide sequence: MAKGSGMIHPNMATMLGVVTTDARVNSDVWRKMVRIAVNRSFNQITVDGDTSTNDTVIALASGLSGLRCISSLDSDEATQLQACLDAVMQGLAKSIAWDGEGATCLIEVTVVGANSEAEAAKVARSVASSSLVKAAVYGRDPNWGRIAAAAGYSGVPFHQSLLRVELGDILLMDGGEPQLFDR*
• ORF Type: complete

Annotations of Ll_transcript_191577

• Blastp: Arginine biosynthesis bifunctional protein ArgJ, chloroplastic from Citrullus with 82.7% of identity
• Blastx: Arginine biosynthesis bifunctional protein ArgJ, chloroplastic from Arabidopsis with 79.89% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440952.1)
• Pfam: ArgJ family (PF01960.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;