Protein coding transcript 203301

• Transcript: Ll_transcript_191581
• CDS coordinates: 674-1141 (+)
• Peptide sequence: MHWASRYFLFVPEKIPGGVTAAEGFKAAGIYGGLRAKGEKPDLALVTCDVDAISAGSFTTNVVAAAPVLYCKRILENSETARAVLINAGQANAATGEAGYQDVIDCVESLAKLLKLKPEEVLVESTGVIGHRIKKGALLNSLPVLLNSLSTSVEG*
• ORF Type: complete

Annotations of Ll_transcript_191581

• Blastp: Arginine biosynthesis bifunctional protein ArgJ, chloroplastic from Populus with 79.47% of identity
• Blastx: Arginine biosynthesis bifunctional protein ArgJ, chloroplastic from Citrullus with 78.2% of identity
• Eggnog: Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis the synthesis of N- acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate (By similarity)(COG1364)
• Kegg: Link to kegg annotations (POPTR_0012s11640g)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440953.1)
• Pfam: ArgJ family (PF01960.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;