Transcript | Ll_transcript_191563 |
---|---|
CDS coordinates | 197-763 (+) |
Peptide sequence | MAATVSSNTYSDDGATDRTPILGDSGSSADESNGLPRRQGIYQAARFLRQASGQRMMREPSVMVRETAAEQLEERQSDWAYSKPVVVLDILWNFAFVATGATVLVLSLNETPSIPLMVWVIGYALQCILHVVCVSIEFRKRRRNRRDESNSNATAAQDGVDGSGDLNSGSGQYQLMPQLGEEGTRNCE* |
ORF Type | complete |
Blastp | E3 ubiquitin-protein ligase At4g11680 from Arabidopsis with 56.74% of identity |
---|---|
Blastx | E3 ubiquitin-protein ligase At4g11680 from Arabidopsis with 55.56% of identity |
Eggnog | zinc ion binding(ENOG41121N2) |
Kegg | Link to kegg annotations (AT4G11680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422461.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer