Protein coding transcript 203310

• Transcript: Ll_transcript_191573
• CDS coordinates: 197-814 (+)
• Peptide sequence: MAATVSSNTYSDDGATDRTPILGDSGSSADESNGLPRRQGIYQAARFLRQASGQRMMREPSVMVRETAAEQLEERQSDWAYSKPVVVLDILWNFAFVATGATVLVLSLNETPSIPLMVWVIGYALQCILHVVCVSIEFRKRRRNRRDESNSNATAAQDGVDGSGDLNSGSGQYQLMPQLGEEGTRECEAGVSTSCLQRWRWALLG*
• ORF Type: complete

Annotations of Ll_transcript_191573

• Blastp: E3 ubiquitin-protein ligase At4g11680 from Arabidopsis with 56.11% of identity
• Blastx: E3 ubiquitin-protein ligase At4g11680 from Arabidopsis with 55.56% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT4G11680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422459.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;