Transcript | Ll_transcript_191418 |
---|---|
CDS coordinates | 152-919 (+) |
Peptide sequence | MLQLSIQRVKKFNSLMPQIYALGTSHFSTAADPSSIKRNPPRVPNLIGGSFVDSKATTFIDVINPATQEVVSQVPLTTDDEFKSAVSSAKKAFSSWRKTPITTRQRVMLKFQELIRRDMDKLALNVTTEQGKTLKDAQGDVFRGLEVVEHACGMATLQMGEYVSNVSHGIDTYSIREPLGVCAGICPFNFPAMIPLWMFPMAVTCGNTFILKPSEKDPGNIFYLFFLSINSHELAFQLDRSLFPILVMVLQHTSI* |
ORF Type | complete |
Blastp | Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial from Arabidopsis with 76.04% of identity |
---|---|
Blastx | Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial from Arabidopsis with 76.04% of identity |
Eggnog | Dehydrogenase(ENOG410XNP1) |
Kegg | Link to kegg annotations (AT2G14170) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423864.1) |
Pfam | Aldehyde dehydrogenase family (PF00171.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer